PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA82G00014
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family B3
Protein Properties Length: 370aa    MW: 42924 Da    PI: 10.6869
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA82G00014genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B350.73.2e-16690195
                EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
          B3  1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                ffk l     + ++ l++pk f+ +h +g   e+k+++l++  s  +W+vk+  ++++    l+ GW+eF+ a++Lk gD+++Fk++++ +f  +v+
  AA82G00014  6 FFKPL--LPGFHTH-LMIPKAFFLKHiKGR-YEQKMVKLRSdASKLTWRVKI--DGRR----LSYGWEEFCVAHDLKIGDIIIFKHEKDLCF--HVT 90
                66666..5666777.9*******9**7444.466799999978889******..9998....899********************9887777..665 PP

2B368.11.3e-21128218696
                 ..-HHHHTT-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
          B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                 ++ ++l+ ++l+lp +fa+e+g++k++ k+++l++ +s++sW + l+ +   ++++l++GW++F++ ngLk+ D+++Fkl++ ++++lv+++
  AA82G00014 128 ISTSSLRYDMLYLPQRFARENGINKQRFKEIVLMSeTSSKSWIFALRQKTLCKTFYLRRGWRSFCSFNGLKVEDSFTFKLTK-RGTTLVLRL 218
                 456788999**************************6667*******88888888*************************987.455556655 PP

3B362.28.3e-20272367299
                 EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
          B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                 ++ ++++ + k+++l+lp +fa+++g+k  ++ +++l d++g +W+  l+ + k++r  l +GWk+F++ang+k g+++ ++l+++++++ v+++++k
  AA82G00014 272 VTLTLRPRYVKRSLLILPIRFARANGIK--QGYKMILLDRHGVKWSTDLRSELKGQRLRLVGGWKGFCHANGVKIGESFKLELVWEENTTAVLRFCSK 367
                 55566677788889***********988..7889****************99999*******************************999999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.0E-21397IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.42E-213101IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.547395IPR003340B3 DNA binding domain
CDDcd100176.99E-16592No hitNo description
SMARTSM010193.2E-23695IPR003340B3 DNA binding domain
PfamPF023623.7E-111487IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.0E-19120218IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.32E-17121218IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.24123222IPR003340B3 DNA binding domain
SMARTSM010193.0E-20124222IPR003340B3 DNA binding domain
CDDcd100171.66E-14128218No hitNo description
PfamPF023626.5E-20128218IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.105.0E-20263367IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.53E-20268366IPR015300DNA-binding pseudobarrel domain
CDDcd100171.47E-15270365No hitNo description
SMARTSM010196.4E-26271368IPR003340B3 DNA binding domain
PROSITE profilePS5086314.297271367IPR003340B3 DNA binding domain
PfamPF023621.4E-19271367IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MANQHFFKPL LPGFHTHLMI PKAFFLKHIK GRYEQKMVKL RSDASKLTWR VKIDGRRLSY  60
GWEEFCVAHD LKIGDIIIFK HEKDLCFHVT PFGPSCCEIQ YTNNHLGKKN PRREIDTPLD  120
HSHLVAKIST SSLRYDMLYL PQRFARENGI NKQRFKEIVL MSETSSKSWI FALRQKTLCK  180
TFYLRRGWRS FCSFNGLKVE DSFTFKLTKR GTTLVLRLSQ TTIPEDDTEA LSLSTEAGSD  240
EERISMESSG RTVKNGRLKW KASSSPAQNR FVTLTLRPRY VKRSLLILPI RFARANGIKQ  300
GYKMILLDRH GVKWSTDLRS ELKGQRLRLV GGWKGFCHAN GVKIGESFKL ELVWEENTTA  360
VLRFCSKVKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294430.11e-132hypothetical protein CARUB_v10023444mg, partial
SwissprotO230761e-104REM15_ARATH; Putative B3 domain-containing protein REM15
TrEMBLR0HTE71e-132R0HTE7_9BRAS; Uncharacterized protein (Fragment)
STRINGBra032078.1-P1e-127(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.11e-105B3 family protein